<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4299 CA10690 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 56
2 D4T 35
3 3TC+AZT+IDV 74
4 D4T+NFV+NVP 48
5 3TC+D4T+NFV 26
6 3TC+AZT+EFV+NFV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L33I, G73S L10I, K14R, L19I, K20I, M36I, R41RK, L63P, I64V, A71V, I93L  
>CA10690| codons 1-99
PQITLWQRPIVTIRIGGQIIEALLDTGADDTVIEEINLPGKWKPKIIGGIGGFIKVRQYD
QIPVEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74LV, M184V, L210W, T215Y   K101E, Y181C, G190A V108I E28K, K122E, D123E, I132X, P133X, I135T, D177E, V179I, H208Y, H221Y, R284K, T286A, I293V  
>CA10486| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSVPL
DEEFRKYTAFTXXSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
CQYVDDLYVASDLEIGQHRTKIEELRQYLWRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTEEAE
L

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005