<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA794 CA10675 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 DDI 43
3 DDC 13
4 D4T 30
5 AZT+D4T 18
6 3TC+AZT+IDV 52
7 D4T+DDI+NVP 19
8 3TC+D4T+RTV+SQV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M   L10I, K20KI, D60E, I62V, L63P, A71V  
>CA10675| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYE
QVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Q151M, M184MV, L210W, T215Y A62V, V75I, F116FY     K20R, V21I, V35I, K43Q, E79D, R83K, K122E, Y181X, G196E, Q197K, F214FL, K223Q, A272P G112GS
>CA10469| codons 1-278
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FVIKRKNSTKWRKLIDFRDLNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVSDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
XQYVDDLYVGSDLEIEKHRTKIEELRQHLWRWGLYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQ

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005