<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1154 CA10663 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+ AZT+ SQV 114
3 3TC+ D4T+ SQV 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, L90M   L10I, E21X, M36MI, I62IV, L63LP, I64V, A71V, I93L  
>CA10663| codons 1-99
PQITLWQRPIVTIKIGGQLKXALLDTGADDTVLEEINLPGRWKPKMIVGIGGFVKVRQYD
QVPVEICGHKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215FV K219Q     E28EA, K43N, K122E, I135IT, D177DE, G196E, Q197K, D218E  
>CA10455| codons 1-245
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEKHRTKIEELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIV

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005