<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4423 CA10634 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 3TC+AZT 17
3 3TC+AZT+IDV 87
4 3TC+DDI+IDV 52
5 D4T+DDI+EFV+NFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70G, M184V, T215F K219Q G190S   E6D, K20R, K49R, K64R, V118I, D123E, I135T, T139K, I178L, T200S, H208Y, R211K, F214L, V245VE  
>CA10634| codons 1-254
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIRKKNSTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVSSDLEIGQHRSKIEELRQYLLKWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L24I, G73ST I3IF, L10I, I15V, G17E, E34A, E35D, M36I, R41K, K55KR, I62V, L63P, I66IM, I72IM  
>CA10828| codons 1-99
PQFTLWQRPIVTIKVGEQLKEALIDTGADDTVLADINLPGKWKPKIIGGIGGFIRVRQYD
QVPIEMCGHKAMSTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005