<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1441 CA10632 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 AZT+DDI 104
3 3TC+AZT+DDI 61
4 AZT+DDI+RTV 26
5 AZT+DDI+IDV+NVP 77
6 3TC+ABC+D4T+EFV+NFV+SQV 52
7 3TC+ABC+D4T+NFV+SQV 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F V75T, K219Q K101E, Y181C, G190S   K20R, V35M, T39E, T69N, R83K, I167V, I202V, D218E, L228H, V245K, D250E, K277R, T286A, E297K  
>CA10632| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKITDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
CQYVDDLYVSSDLEIGQHRTKVEELRQHLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53FL, Q58E L10I, I15V, K20R, E35D, M36I, N37E, W42Y, K55R, R57K, I62V, L63P, A71V  
>CA10841| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIELPGRYKPKLIGGIGGLVRVKEYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005