<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4414 CA10622 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 12
2 AZT+ 3TC 9
3 DDI+ D4T+ NVP 24
4 D4T+ NVP 43
5 D4T+ EFV+ SQV 12
6 D4T+ EFV+ SQV 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K103N, Y181C K238KT D17G, T27S, E42EG, K49R, V60I, R83RK, V90I, D123E, I135LV, D177E, R211K, T240TA  
>CA10622| codons 1-246
PISPIETVPVKLKPGMGGPKVKQWPLSEEKIKALVEICTEMGKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDTWA
VQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, N37D, D60E, L63S  
>CA10829| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QISIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005