<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4383 CA10588 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 91
2 3TC+AZT 96
3 D4T+DDI+NVP 22
4 D4T+NFV+NVP 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215Y   K103N, Y181C   K64R, T69N, R83K, V90I, I135T, S162A, E169D, V179VI, R211N, A272P, K277R, T286A, E297K  
>CA10588| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSNRWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILDPFRKQNPDIII
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D K14R, I15V, K20T, E35D, M36I, R41K, L63P, A71AV  
>CA10798| codons 1-99
PQITLWQRPLVTIRVGGQLTEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009