<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4375 CA10578 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 AZT+3TC 21
3 D4T+3TC+IDV 56
4 3TC+AZT+DDI+IDV+NVP 12
5 D4T+DLV+NFV+SQV 107

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N, Y188L   K20R, E44D, V60I, K102N, V118I, K122E, I142V, Q197E, T200A, I202V, H208Y, V245E  
>CA10578| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKNNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGEHRAKVEELRQYLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, I84V, L90M K43T L10I, E35DN, M36I, F53Y, I62V, L63Q, I64V, A71V, I93L  
>CA10788| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWTPKIIGGIGGYVKVRQYD
QVQVEICGHKVIGTVLVGPTPFNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009