<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2206 CA10568 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV 52
2 3TC+AZT+IDV 135
3 3TC+D4T+EFV+NFV 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   G190S   K43Q, E44D, K49KR, V60I, V118I, K122E, I135T, R211K, T240TA, A272P, Q278H, I293V  
>CA10568| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWA
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73C L10I, L24M, N37H, I62V, L63P, I64V, T74S, V77I, I85V, I93L  
>CA10778| codons 1-99
PQITLWQRPIVTIKIGGQLKEALMDTGADDTVLEEMHLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKAICSVLIGPTPVNVVGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005