<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1148 CA10560 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI+ AZT 91
3 SQV+ D4T+ 3TC 30
4 IDV+ DDI+ AZT 27
5 SQV+ RTV 8
6 SQV+ RTV+ AZT+ 3TC 59
7 SQV+ RTV+ D4T+ AZT+ 3TC 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219N     K20R, E44D, V60I, K122KE, D123E, I142V, S162Y, G196E, Q197K, E203D, H208F, R211K, S251I, A272P, I293V  
>CA10560| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRTKIDELRQFLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDIWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54V, V82AS, L90M F53L L10I, L33M, E34Q, N37H, R57RK, Q61E, L63E, I64V, E65D, A71V  
>CA10769| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIMQEMHLPGRWKPKMIGGIGGLVKVKQYD
EIEVDICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005