<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4330 CA10521 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 DDI 48
3 AZT+DDI 48
4 3TC+AZT+RTV 35
5 3TC+AZT+IDV 52
6 3TC+AZT+NFV 83

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V T215S, K219Q     D17DG, K20R, V35L, V60I, K103R, V118I, K122E, S134SC, K173E, Q207E, F214L, L228H, K277R, A288T, I293V, E297K P25PA
>CA10521| codons 1-302
PISPIETVPVKLKPGMGGPRVKQWALTEEKIKALLEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPCINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGLSTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKTLTEVVPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L63P  
>CA10730| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRSLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009