<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4328 CA10519 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 104
2 NRTI 52
3 AZT+DDC 52
4 3TC+D4T 52
5 NRTI 52
6 3TC+AZT+IDV 25
7 3TC+AZT+DDI+NVP 4
8 3TC+AZT+DDI+RTV+SQV 47
9 D4T+DDI+NVP 26
10 3TC+ABC+D4T+IDV+RTV 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, M184V, L210W, T215Y   Y181C   D17DG, E44D, V60I, V111X, K122E, S134SC, S162D, E169D, H208Y, R211K Y144YS
>CA10519| codons 1-252
PISPIETVPVKLKPGMGGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDXGDAYFSVPL
DEDFRKYTAFTIPCINNETPGIRSQYNVLPQGWKGSPAIFQDSMTKILDPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F, L33I, G73S T4A, L19I, E35D, M36I, R57K, L63P, A71V, I72F, I85V  
>CA10728| codons 1-99
PQIALWQRPFVTIKIGGQIKEALLDTGADDTVIEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKVFSTVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005