<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA790 CA10499 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 365
2 AZT+DDC 22
3 3TC+AZT 31
4 3TC+AZT+IDV 9
5 3TC+D4T+IDV 60
6 D4T+DDI+RTV+SQV 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219Q     V35I, T39A, K49KR, D123DE, I135T, V179I, D218E, E248D, I293V, E297A  
>CA10499| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012