<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4291 CA10476 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 13
2 AZT+ DDC 26
3 3TC+ AZT 52
4 D4T+ DDI+ NFV 70
5 D4T+ DDI 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, T215F K219Q     K20R, Q23X, V60I, K103R, V118I, I135T, G196E, R211G, F214L  
>CA10476| codons 1-267
PISPIETVPVKLKPGMDGPRVKHWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLGWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90LM   K20I, N37DH, D60E, L63P  
>CA10682| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYE
QIPIEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001