<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1158 CA10467 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 42
2 AZT+DDI 10
3 3TC+AZT+IDV 44
4 AZT+IDV+NVP 9
5 3TC+AZT+NFV+SQV 35
6 None 10
7 ADV+DDI+EFV+RTV+SQV 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y V75L K103N, G190A   K43N, K122E, E138A, I142V, S162C, R211Q, L228R, K277R, Q278H  
>CA10467| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLWQWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLC

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L L10LI, E35D, M36V, R57K, D60E, I62V, L63P, A71V, I93L  
>CA10673| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDVNLPGRWKPKMIGGIGGLVKVKQYE
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005