<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JL-Pt11 JL-11-pre U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDC NA
3 3TC+D4T+SQV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, E35D, N37S, R41K, I62V, L63P, A71V, I93L  
>JL-11-pre| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Q151M, M184V, T215Y K70S, F116Y     T58S, D121H, K122E, I135V, D177E, K277R F77V
>JL-11-pre| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNSPV
FAIKKKNSTSWRKLVDVRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTEEAE
LE

References
Author Title Citation
Lawrence, J Clinical resistance patterns and responses to two sequential protease inhibitor regimens in saquinavir and reverse transcriptase inhibitor-experienced persons. J Infect Dis, 1999
Winters, MA Human immunodeficiency virus type 1 protease genotypes and in vitro protease inhibitor susceptibilities of isolates from individuals who were switched to other protease inhibitors after long-term saquinavir treatment. J Virol, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005