<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1313 CA10393 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+AZT 52
3 AZT+DDI+SQV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, L63P, A71T, I72E, V77I, I93L  
>CA10393| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       M16MV, K20R, T39TA, V60I, R83K, V90I, V118I, K122E, I135T, S162FY, E169D, G196E, Q207E, R211K  
>CA10392| codons 1-252
PISPIETVPVKLKPGVDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Lawrence, J Clinical resistance patterns and responses to two sequential protease inhibitor regimens in saquinavir and reverse transcriptase inhibitor-experienced persons. J Infect Dis, 1999
Winters, MA Human immunodeficiency virus type 1 protease genotypes and in vitro protease inhibitor susceptibilities of isolates from individuals who were switched to other protease inhibitors after long-term saquinavir treatment. J Virol, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005