<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A1424 A1424_C1 Mali 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   K32E, V35T, E36A, T39K, K43E, K122E, D123S, I135R, I142V, S162Y, K173T, Q174K, D177E, V179I, Q197E, Q207A, R211K, V245Q, A272P, T286A, E291D, V292I, I293V, E312D, I326V, G335D, M357K, G359S, K366R, T369V, A371V, I375V, A376V, T386A, K388R, A400T, T403M, W410Y, E432D, V435I  
>A1424_C1| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIEALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPEIII
YQYVDDLYVASDLEIGEHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLVEVVQKVVTESIVIWGKAPRFKLPIQKETWETWWMEYWQATYIPEWEFVNTP
PLVKLWYQLEKDPIIGAETF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12P, I13V, K14R, G16E, E35D, M36I, R41K, L63V, H69K, K70R, L89M  
>A1424_C1| codons 1-99
PQITLWQRPVVPVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Sylla, M Characterization of drug resistance in antiretroviral-treated patients infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther, 2008