<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B7173 B7173_C2 Mali 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDI+IDV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74V, M184I       V35T, T39E, S48T, V60I, A98S, D121H, K122E, I135V, K173A, Q174K, P176T, I178L, T200A, Q207E, R211K, V245M, D250E, A272P, K277R, T286A, E291D, V292I, I293V, D324E, Q334H, G335D, R356K, G359T, T377M, K390R, A400T, E404D, V435VI  
>B7173_C2| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNTDLVI
YQYIDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L10F, T74P T12S, I13V, I15V, L19V, M36I, L63V, I64V, H69K, L89M, I93L  
>B7173_C2| codons 1-99
PQITLWQRPFVSVKVGGQVKEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIVVEICGKKAIGPVLVGPTPVNVIGRNMLTQLGCTLNF

References
Author Title Citation
Sylla, M Characterization of drug resistance in antiretroviral-treated patients infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther, 2008