<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A2536 A2536_C1 Mali 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q, N348I K103N, Y188L   K11Q, V35T, T39L, K49R, K122E, D123N, S134R, I135V, S162A, E169Q, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, P243Q, V245Q, T286A, E291D, I293V, P294T, S322T, G335D, R356K, M357R, G359S, A371V, I375V, A376T, T377M, T386A, K390R, T403M, E432D N136I, I159L
>A2536_C1| codons 1-440
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPRVINETPGIRYQYNVLPQGWKGSPALFQASMTKILQPFRTKNPEMVI
YQYVDDLLVGSDLEIGQHRAKIEELREHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQQIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKILKTGKYAKRRSA
HTNDVKQLTEVVQKVTMESIVIWGKAPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G48W M36I, R41K, I64M, H69K, L89M  
>A2536_C1| codons 21-99
EALLDTGADDTVLEEINLPGKWKPKMIWGIGGFIKVRQYDQILMEICGKKAIGTVLVGPT
PVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Sylla, M Characterization of drug resistance in antiretroviral-treated patients infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther, 2008