<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D604 D604_C2 Burkina Faso 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E K103N, G190A   E28K, K32E, V35T, V60I, K122E, I135T, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, D250E, T286A, I293V, S322T, D324E, I326V, G335D, A355S, R356K, M357K, G359S, A371V, I375V, T377Q, K390R, K395R, E396D, E413D, E432D, V466I, T470P, D471E, Q480H, L491S, Q509H, K512R, S519N, I522L, Q524K, K527E, E529D, A534S  
>D604_C2| codons 1-539
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKELVAEIQKQGQDQWTYQIYQEPFKNLKTGKYSKKRSA
HTNDVKQLTEVVQKVAQESIVIWGKTPKFRLPIQRDTWEAWWTEYWQATWIPDWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKIVSLPETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAHPDRSESELVNQILEKLIEKDKVYLSWVPAH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I13V, K14R, G17E, K20I, E35N, M36I, R41K, I62V, L63S, H69K, T74S, L89M  
>D604_C2| codons 1-99
PQITLWQRPLVIVRIGEQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QVSIEICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Sylla, M Characterization of drug resistance in antiretroviral-treated patients infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther, 2008