<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C1078 C10781_C1 Mali 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, I15L, K20I, M36I, R41K, L63S, H69K, K70R, L89M  
>C10781_C1| codons 1-99
PQITLWQRPIVTVRLGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N A98G, V179E K20R, E28K, V35T, E36D, K122E, I135T, I142V, S162A, E169A, K173T, Q174S, D177E, T200A, Q207E, L228R, V245Q, D250E, T286A, I293V, P294T, E312D, I326V, M357K, R358T, G359S, K366R, T369V, A371V, I375V, A376V, T386A, A400T, T403M, E432D, V435A  
>C10781_C1| codons 1-440
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALTDICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILAPFRTSNPEIEI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARKTSA
HTNDVRQLVEVVQKVVTESIVIWGKAPKFKLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETF

References
Author Title Citation
Sylla, M Characterization of drug resistance in antiretroviral-treated patients infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther, 2008