<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B7127 B7127_C2 Mali 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G17E, K20I, E35N, M36I, R41K, K45R, R57K, L63S, H69K, K70R, I72T, L89M  
>B7127_C2| codons 1-99
PQITLWQRPLVTVKIGEQLIEALLDTGADDTVLENINLPGKWKPRMIGGIGGFIKVKQYD
QISIEICGKRATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184I V75I, F116Y, K219N Y181C, G190S   K20R, A33V, V35T, T39A, I47L, K49R, V60I, K122E, D123N, S162A, K166R, K173T, Q174R, D177E, T200A, Q207E, R211K, V245M, E248D, S251C, A272P, K277R, T286A, E291D, V292I, I293V, P294T, S322A, G335D, M357Q, G359S, K366R, T369A, A371V, I375V, A376S, K390R, K395R, T403M, E432D, V435A, V467I, Q480H, H483D, L491S, Q509L, K512R, S519N, I522L, Q524K, K527G, E529D, A534S I37M, T165S
>B7127_C2| codons 1-536
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKVLTEMCAEMEKEGKLSRIGPENPYNTPI
FAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQASMSRILEPFRTRNPEIVI
CQYIDDLYVSSDLEIGQHRAKIEELREHLLKWGFTTPDNKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKDCWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARQRSA
HTNDVRQLAEVVQKVSTESIVIWGKTPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLTDTTNQKTELH
AIDLALQDSGSEVNIVTDSQYALGIIQALPDRSESELVNQILEKLIGKDKVYLSWV

References
Author Title Citation
Sylla, M Characterization of drug resistance in antiretroviral-treated patients infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther, 2008