<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A2546 A2546_C1 Mali 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 13
2 3TC+AZT+NVP 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   K103N, Y181C P225H V35T, S68G, K122E, I135V, S162T, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, H221Y, V241I, P243T, V245Q, K281R, L283I, T286A, E291D, V292I, I293V, P294T, L295M, S322A, G335D, R356K, M357K, G359S, A371V, I375V, K390R, A400T, T403R, E432D, V435M, V467I, T470S, D471E, Q480H, L491S  
>A2546_C1| codons 1-499
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRTKNPEMVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFFTPDKKYQKEHPFLWMGYELHPDKWT
IQTIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLIRGAKALTDIVTMTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQKETWETWWREYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIMGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLSETTNQKTELH
AIHLALQDSGSEVNIVTDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19P, K20I, M36I, N37D, R41K, I64L, H69K, K70R, L89M  
>A2546_C1| codons 1-99
PQITLWQRPLVTVKIGGQPIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILLEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Sylla, M Characterization of drug resistance in antiretroviral-treated patients infected with HIV-1 CRF02_AG and AGK subtypes in Mali and Burkina Faso. Antivir Ther, 2008