<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
fj69 fj69 China 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103N, Y181C   E6D, K11T, L34I, V35T, T39Q, V60I, S68G, K122E, D123S, K166R, K173I, Q174K, D177E I178K, S191F
>fj69| codons 1-199
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKAITEICQEMEKEGKISKIGPENPYNTPI
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEKVI
CQYMDDLYVGFDLEIGQHR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, H69K, L89M  
>fj69| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Liu, J Polymorphisms and drug resistance analysis of HIV-1 CRF01_AE strains circulating in Fujian province, China. Arch Virol, 2007