<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
fj63 fj63 China 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, K20R, E35D, M36I, R41K, H69K, L89M, I93L  
>fj63| codons 1-99
PQITLWQRPLVTIKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, T39K, K43E, K122E, D123S, I135L, K166R, R172K, K173I, Q174K, D177E, I178M, G196E G141R
>fj63| codons 1-199
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPRIRYQYNVLPQGWKGSPAIFQSSMTRILEPFKIKNPEMVI
YQYMDDLYVGSDLEIEQHR

References
Author Title Citation
Liu, J Polymorphisms and drug resistance analysis of HIV-1 CRF01_AE strains circulating in Fujian province, China. Arch Virol, 2007