<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LP38 01SP-LP38 Spain 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V       V35T, E36D, V60I, K122E, D123S, I135V, S162A, K173A, Q174K, D177E, T200A, Q207E  
>01SP-LP38| codons 21-210
VKQWPLTEEKIKALTDICTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSVNNETP
GIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVIYQYVDDLYVGSDLEIGQHRA
KIEELREHLL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K20I, M36I, N37S, R41K, H69K, L89M  
>01SP-LP38| codons 1-99
PQITLWQRPLVTAKIGGQLIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A Genetic characterization of complex inter-recombinant HIV-1 strains circulating in Spain and reliability of distinct rapid subtyping tools. J Med Virol, 2008