<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
X623 X623 Spain 2000 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ D4T+ NFV+ NVP+ IDV NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, S17N, V31I, L101I, T112I, T124S, T125A, G134N, K136T, G163T, V201I, T206S, K211R, Y227F, L234I, S255N, D256E, D270H S283G
>X623| codons 1-288
FLDGIDKAQEEHERYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSSAVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIITQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTRELQKQITKIQNFRVYFRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRHYGKQMAGDDCVAGRQDED

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K43R, V60I, A98S, K122E, D123N, I135T, K173I, Q174K, D177E, T200A, I202V, Q207G, R211S, V245Q, E248N, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D320E, D324E, I329V, Q334L, G335D, F346Y, R356K, M357R, R358G, G359S, V365I, E370D, A371L, Q394R, A400V, E413D, Q428R, K431T, V435A, F440Y, R461K, R463K, V466I, V467I, S468T, D471E, T477A, H483Q, L484I, L491S, K512R, S519N, A534S, A554S  
>X623| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELRGHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQGLDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDIKQLTDLVQKIATESIVIWGKTPKFKLPIRKETWEVWWTEYWQATWIPDWEFVNTP
PLVKLWYRLETEPIAGAETYYVDGAANRETKLGKAGYVTDKGKQKIITLTETTNQKAELQ
AIQIALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Perez-Alvarez, L HIV-1 subtype G and BG recombinant viruses in Spanish natives: Evidence of characteristic mutations in reverse transcriptase and protease. AIDS, 2001
Delgado, E Identification of a newly characterized HIV-1 BG intersubtype circulating recombinant form in Galicia, Spain, which exhibits a pseudotype-like virion structure. JAIDS, 2002