<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML2014 ML2014 Kenya 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G16E, E35D, M36I, P39S, R41K, R57K, L63S, H69K, L89M  
>ML2014| codons 1-99
PQITLWQRPIVTVRIEGQLKEALLDTGADDTVLEDINLSGKWKPKMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, D121H, K122E, I135T, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, V245Q, K249R, D250E, I257IV, T286A, E291ED, I293IV, P294T, E312DH, G335D, M357K, G359S, A360AT, K366R, A371V, I375V, A376V, T377M, A400T, T403M, E404D, E432D, V435E, F440Y, S468T, D471E, T477A, Q480H, L491S, K512R, S519N, Q524K, K527G, E529D, A534S, A554S, V559I  
>ML2014| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPERESWTVNDVQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKHPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRST
HTNDVRQLTEVVQKVVMESIVIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIEGAETYYVDGAANRETKLGKAGYVTDRGRQKVVTLTETTNQKAELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKIL

References
Author Title Citation
Land, AM Full-length HIV type 1 proviral sequencing of 10 highly exposed women from Nairobi, Kenya reveals a high proportion of intersubtype recombinants. ARHR, 2008