<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML1974 ML1974 Kenya 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41K, L63P, V77I  
>ML1974| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11Q, K20R, V35T, T39M, V60I, D121H, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, Q197E, T200A, Q207A, R211S, V245M, E248D, T286A, E291D, I293V, P294T, E312D, G335D, M357Q, R358K, G359S, A371V, I375V, A376V, T377L, T386I, K390R, A400T, T403M, E404D, E432D, V467I, D471E, Q480H, L491S, K512R, S519N, Q524K, K527G, E529D, A534S, A554S  
>ML1974| codons 1-560
PISPIETVPVQLKPGMDGPRVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGEHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARQKSA
HTNDVKQLTEVVQKVVLESIVIWGKIPKFRLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, I72V, T112V, I113V, T124A, G193E, K211R, D278S S283G, D286N
>ML1974| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGSDCVAGRQNED

References
Author Title Citation
Land, AM Full-length HIV type 1 proviral sequencing of 10 highly exposed women from Nairobi, Kenya reveals a high proportion of intersubtype recombinants. ARHR, 2008