<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML1956 ML1956 Kenya 2001 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S24H, V32I, I72V, E96D, L101I, T112V, T124A, T125A, K136Q, I182V, V201I, K215R, Q216N, L234I, D279DG S283SG
>ML1956| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMAHDFNLPPVIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQDTAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FVHNFKRKGGIGGYSAGERIIDIIATDIQTKELQRNITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDGCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, M36I, R41K, L63T, H69Q  
>ML1956| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, I135R, I142V, D177E, I178M, T200I, Q207E, R211K, K238R, V245K, D250E, A272P, K277R, L282C, L283I, V292I, I293V, P321Q, G335D, F346L, R356K, G359T, T377Q, S379C, K385R, K390R, E399D, A400T, E413ED, V435IM, L469I, H483N, L491S, A534S, A554S  
>ML1956| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDQSKDLIAEIQKQGQDQWTYQIYQEPLKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAQECIVIWGRTPKFRLPIQKETWDTWWTEYWQATWIPDWEFVNTP
PLVKLWYQLEKEPIMGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSITDTTNQKTELQ
AINLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Land, AM Full-length HIV type 1 proviral sequencing of 10 highly exposed women from Nairobi, Kenya reveals a high proportion of intersubtype recombinants. ARHR, 2008