<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
60602-02 02_60602-2 Spain 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, L33V, E34A, R41K, I62V, L63H, G68E, H69R, L89M  
>02_60602-2| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVVAEMNLPGKWKPKMIGGIGGFIKVRQYD
QVHIEICERKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A Differences in the length of gag proteins among different HIV type 1 subtypes. ARHR, 2005