<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
316-98 98_316-98 Spain 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, K43R, H69K, L89M  
>98_316-98| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A Differences in the length of gag proteins among different HIV type 1 subtypes. ARHR, 2005