<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LP57 02_LP57 Spain 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3V, L10I, I13V, K14R, K20I, E35N, M36I, R41K, L63P, I64M, H69K, V82I, L89M  
>02_LP57| codons 1-99
PQVTLWQRPIVTVRIGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QIPMEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A Differences in the length of gag proteins among different HIV type 1 subtypes. ARHR, 2005