<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
590 590_2004 Romania 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, K20R, E35D, M36I, R41K, K45KR, R57K, L63T, E65D, I72T, T74S, L89M  
>590_2004| codons 1-99
PQITLWQRPLVSIKVGGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QITIDICGHKATGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39A, E40D, V60I, D123E, I135L, S162H, K173R, Q174K, V179VI, T200A, Q207A, R211K, E224ED, V245Q, E248N, A272P, T286A, E291D, V292I, I293V, P294T, E297T, A304E  
>590_2004| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRRKNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKDPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTTEAE
LELEENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Paraschiv, S Polymorphisms and resistance mutations in the protease and reverse transcriptase genes of HIV-1 F subtype Romanian strains. Int J Infect Dis, 2007