<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cam10 Cam10DBS Cameroon 2003 HIV1 CRF02_AG Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F K20I, M36I, N37S, R41K, C67Y, H69K, V77I, L89M K70KMRT
>Cam10DBS| codons 17-99
GQLIEALLDTGADDTVFEEISLPGKWKPKMIGGIGGFIKVRQYDQILIEIYGKTAIGTVL
IGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6T, V35T, E36D, T39K, K43E, S48T, K49R, A62P, D123K, I135L, S162A, K173V, Q174K, D177E, T200A, Q207E M16MR, K122M, F124T, R125*LSW, Y127N
>Cam10PL| codons 1-244
PISPITTVPVKLKPGRDGPKVKQWPLTEEKIKALTDICKEMEEEGKITRIGPENPYNTPV
FPIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DMKTWKNTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRVKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
McNulty, A Evaluation of dried blood spots for human immunodeficiency virus type 1 drug resistance testing. J Clin Microbiol, 2007