<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cam10 Cam10PL Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F M36I, N37S, R41K, C67Y, H69K, V77I, L89M  
>Cam10PL| codons 21-99
EALLDTGADDTVFEEISLPGKWKPKMIGGIGGFIKVRQYDQILIEIYGKKAIGTVLIGPT
PVNIIGRNMLTQIGCTLNF

References
Author Title Citation
McNulty, A Evaluation of dried blood spots for human immunodeficiency virus type 1 drug resistance testing. J Clin Microbiol, 2007