<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cam20 Cam20DBS Cameroon 2003 HIV1 A Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35N, M36I, N37D, R41K, L63P, H69X, L89M  
>Cam20DBS| codons 17-99
GQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGNKAIGTVL
VGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11A, V35M, T39K, K64X, D121Y, K122E, D123G, E169D, K173A, Q174K, D177E, G196E, Q207A, R211S  
>Cam20PL| codons 1-230
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALMEICKEMEKEGKISKIGPENPYNTPV
FAITKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
McNulty, A Evaluation of dried blood spots for human immunodeficiency virus type 1 drug resistance testing. J Clin Microbiol, 2007