<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cam32 Cam32PL Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6N, V8I, K11T, V35T, E40D, V118I, D121H, K122E, D123S, I142V, F171Y, K173S, D177E, I202V, Q207A, R211S, F214L  
>Cam32PL| codons 1-244
PISPINTIPVTLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPYRSQNPEIVI
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, K20I, E35D, M36I, L63GISV, H69K, L89M  
>Cam32PL| codons 7-99
QRPIVTVKIEGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYDQIVIEI
CGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
McNulty, A Evaluation of dried blood spots for human immunodeficiency virus type 1 drug resistance testing. J Clin Microbiol, 2007