<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt1 Pt1 Gabon 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT+LPV 9
2 3TC+ABC+DDI+LPV 87
3 3TC+ABC+DDI+TDF 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70E, M184V       K20R, V35T, T39K, E40D, V60I, K122E, D123S, K166R, K173T, Q174K, D177E, I178M, T200A, Q207A, R211K, V245Q, E248D, D250E P157S
>Pt1| codons 1-256
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKDMEKEGKISKIGPENPYNTPI
FAIKRKDSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSSAIFQSSMTRILEPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVND

References
Author Title Citation
Delaugerre, C Selection of a rare resistance profile in an HIV-1-infected patient exhibiting a failure to an antiretroviral regimen including tenofovir DF. J Clin Virol, 2005