<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CTL 018 CTL 018 Denmark 2007 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10D, E13Q, K34R, M50I, I72V, L101I, K111T, T124N, I135V, I220L  
>CTL 018| codons 1-288
FLDGIDKAQDEHQKYHSNWRAMASDFNLPPVVAREIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVTTIHTDNGSN
FTSNTVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKLQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, E35D, M36I, R57K, D60E, L63S, I64V, V77I, I93L  
>CTL 018| codons 1-99
PQITLWQRPLVPIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYE
QISVEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, E169D, R211K, T286A, I293V, V317A, D324E, T386I, A400V, T403A, P421L, D460N, R461K, L469I, H483L, L491V, I495V  
>CTL 018| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWEVWWAEYWQATWIPEWEFVNTP
LLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVSITDTTNQKTELQ
AILLALQDSGVEVNVVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Andresen, BS Characterization of near full-length genomes of HIV type 1 strains in Denmark: Basis for a universal therapeutic vaccine. ARHR, 2007