<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CTL 016 CTL 016 Denmark 2007 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, R20K, V32I, I72V, L74I, P90S, T112V, K156N, V165I, H171L, V201I, D256E  
>CTL 016| codons 1-288
FLDGIDKAQEDHEKYHSNWKAMASDFNLPPVIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVISAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIGQIRDQAELLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, N37S, I62V, L63P, H69Y  
>CTL 016| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, I135R, T200A, F214L, V245Q, D250E, Q278H, I293V, E300Q, I329L, S379G, V381I, K390R, A400L, E404D, V435E, L452T, D460S, S468P, H483Y, A554Q, K558R  
>CTL 016| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTEEAQ
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATEGIIIWGKTPKFRLPIQKETWELWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKTGKAGYVTSRGRQKVVPLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSQGIRRVL

References
Author Title Citation
Andresen, BS Characterization of near full-length genomes of HIV type 1 strains in Denmark: Basis for a universal therapeutic vaccine. ARHR, 2007