<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
N03 N03 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, R41K, K43R, R57K, Q61N, L63Q, I72E, Q92K  
>N03| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD
NIQIEICGHKAEGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35M, S48T, V60I, I135T, Q207E, L228P, A272P, V276VI, K281R, T286V, V292I, I293V, E297R, Q334L, G359S, I375V H235HR
>N03| codons 1-385
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFPWMGYELRPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCRLLRGVKALTEIVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKVATESIVIWGK

References
Author Title Citation
Dilernia, DA HIV type 1 genetic diversity surveillance among newly diagnosed individuals from 2003 to 2005 in Buenos Aires, Argentina. ARHR, 2007