<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1600 CA10020 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 260
2 AZT+DDI 47
3 None 13
4 3TC+AZT+SQV 21
5 3TC+D4T+IDV 52
6 RTV+SQV 4
7 3TC+AZT+NVP 34
8 3TC+AZT 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, R57K, L63P, I64L, A71V, I72V, V77VI  
>CA10020| codons 10-99
IVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFTKVKQYDQIPLEICGH
KVVGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, M184V, L210W, T215Y D67G, K219DE     V35M, T39A, E40F, K43E, V60I, S68G, R83K, K104R, V118I, K122E, D177N, T200A, R211K, L228H, T286A, E291D, E297K, E300R, L301A, L303T E302R
>CA9954| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAFLEEEGKISKIGPENPYNTPI
FAIKKKGGTKWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDDKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVIPLTKEAR
ART

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005