Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1277 | CA10012 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 74 |
| 2 | D4T | 30 |
| 3 | DDI | 68 |
| 4 | AZT+ DDC | 48 |
| 5 | None | 60 |
| 6 | 3TC+ AZT | 7 |
| 7 | 3TC+ AZT+ IDV | 8 |
| 8 | 3TC+ AZT+ NFV | 62 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L23I | N37T, L63P, T74S, V77I, V82I, I93L |
| >CA10012| codons 1-99 PQITLWQRPLVTIKIGGQLKEAILDTGADDTVLEEMTLPGRWKPKMIGGIGGFIKVRQYD QIPIEICGHKAIGSVLIGPTPINIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |