<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1277 CA10012 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 74
2 D4T 30
3 DDI 68
4 AZT+ DDC 48
5 None 60
6 3TC+ AZT 7
7 3TC+ AZT+ IDV 8
8 3TC+ AZT+ NFV 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L23I N37T, L63P, T74S, V77I, V82I, I93L  
>CA10012| codons 1-99
PQITLWQRPLVTIKIGGQLKEAILDTGADDTVLEEMTLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLIGPTPINIIGRNLLTQLGCTLNF

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005