<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA796 CA10007 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDI 266
3 3TC+D4T+SQV 39
4 D4T+DDC+NFV 17
5 3TC+AZT+IDV+NVP 17
6 3TC+AZT+IDV 10
7 3TC+AZT+RTV+SQV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53L, G73S L10I, L24LF, N37D, D60E, L63P, A71IV, V77I, I93L  
>CA10007| codons 1-99
PQITLWQRPIVTIKIGGQLKEALFDTGADDTVLEEMDLPGRWKPKIIGGIGGLIKVRQYE
QIPIEICGHKIISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F V75M, K219W K103KN, Y181C   V35T, V60I, I94L, K122E, I135T, V179I, H208Y, D218E, L228H, V245E, E248Q, A272P, A288S, V292I, I293V  
>CA9945| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGLPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVGSDLEIGQHRTKIEELRQYLLRWGFFTPEWKHQKEPPFHWMGYELHPDKWT
VQPIELPQKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEIVPLTEEAE
LEL

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005