<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4167 CA10004 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 3TC+AZT 21
3 3TC+AZT+RTV 39
4 3TC+D4T+SQV 13
5 3TC+D4T+RTV 43
6 D4T+NVP+NFV 21
7 DDI+EFV+NVP 17
8 DDI+EFV+IDV+RTV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L, G73GC L10I, I15V, K20R, M36I, N37D, K55R, D60E, I62V, L63P, A71V, I72E, Q92QR  
>CA10004| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGLVRVRQYE
QVPIEICGHKVECTVLVGPTPANIIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74V, T215F K219Q Y181C, G190A V179D E79D, A98S, K122E, Q174R, G196E, T200A, E203K, Q207E, D218E, T240TA, V245K, T286A, A288T, V292I, E297K  
>CA9938| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRDLNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIDI
CQYMDDLYVASDLEIEQHRAKIKELREHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWA
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKTLTEIIPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005