Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

HIV Home HBVseq HBV RT Mutations Blast Hits DB Release Notes

HBV RT: BLAST Hits

AuthorsTitleCitationE-value# in HBVDB# in Gb% in HBVDBAnnotation
Zaaijer (2008) Multiple surface antigen mutations in five blood donors with occult hepatitis B virus infection J. Med. Virol. 80 (8), 1344-1349 (2008) 1e-173 2 7 29 HBVDB

Download amino acid sequences: aligned
Download nucleic acid sequences: aligned or unaligned

AccessionCountryColleDateGBCloneNameGBNoteGenotypeSEMutList
EU155889 Spain       D 110 278 118D,120S,124Q,129I,130P,131T,135H,187L,224I,257*Y,268R,269HN,278I
EU155890 Spain       D 110 278 118D,120S,124Q,129I,130P,134N,135H,187L,224I,248N,256S,266V,268R,278I
EU155891 Spain       D 16 248 18S,21S,112I,122L,124Q,130P,135Y,142T,153Q,213X,214X,215X,216X,217X,218X,219X,220X,221X,222X,223X,224X,225X,226X,227X,228X,229X,230X,231X,232X,233X,234X,235X,236X,237X,238X,239X,240X,241X,242X,243X,244X,245X,246LMV,247R
EU155892 Spain       D 124 206 128I,162T,187L
EU155893 Spain       D 1 344 16T,21S,39K,119F,122L,129L,130P,131T,134N,135N,143C,145M,221Y,248N,256G,259A,263E,266R,278I
EU155894 Spain       D 124 206 126Q,128N,130P,131K,134A,135E
EU155895 Spain       D 1 308 21S,35Q,110G,119A,120S,122L,123K,126Q,128H,130P,131K,135T,207M,248N,263E,278I,279X,280X,280X_XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX*GILQRLFV*RLGGVGGGD*IKGLCTRRL*A*IGLRTSTMQLFHLCLIISCSCPTVQASKLCLGWL*GMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC*YSLDS*GGELYWALFFYCTCL*SSLENTIFS*YTSTPRHYQKM*TVCRPTYS**EKKIAIDYACQVLSKGYQIFTIG*GY*TLLSRTSS*SLFPN*TLFTHSMEGGYII*ERNKS*RLILWVTIFLGTRSAPSTAWGRIFPPAILWDSFPTTSWIQPSEQTPQIQIGTSIPTRTPGQTPTR*ELEHSGWVSPHRTEVFWGGALRL,281X,282A,283Y,284Y,286L,289Q,291R,292L,295X,296H,297Q,298S,300V,301R,302K,303A,304A,308V

Team

Resources