Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

HIV Home HBVseq HBV RT Mutations Blast Hits DB Release Notes

HBV RT: BLAST Hits

AuthorsTitleCitationE-value# in HBVDB# in Gb% in HBVDBAnnotation
Gao (2008) Direct Submission Submitted (05-DEC-2007) The Institute of Clinical 1e-178 12 16 75 HBVDB

Download amino acid sequences: aligned
Download nucleic acid sequences: aligned or unaligned

AccessionCountryColleDateGBCloneNameGBNoteGenotypeSEMutList
EU330986 China       C 1 133 9Y,13H,131L,132F
EU330987 China       B 1 166 79S,80F,81S_LCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVE,83T,84L,85F,86F,89*,90L,92S,93F,95S,96R,97S,98P,99R,101R,103Y,104S,105V,108G,109L,111V,112S,113G,114T,116F,117T,118S,119P,120Y,121G,122T,123Q,124A,125S,126Y,127S,128V,129L,129L_VS**I*PPGWE,130G,133E,135P,136A,139E,141V,144Y,145V,146N,147V,148N,149M,150G,151L,152K,153I,154R,155Q,156L,158W,161I,162S,163C,165T
EU330988 China       B 121 344 134D,207I,253I,256G,267W,271Q,278I,332N
EU330989 China       B 1 344 76D,123S,134D,145V,169T,207M,253I,256G,267W,271Q,278I,309L,332N
EU330990 China       B 1 344 76D,123S,134D,145V,169T,207M,253I,256G,267W,271Q,278I,309L,332N
EU330991 China       B 121 344 134D,207M,253I,256G,267W,271Q,278I,309L,332N
EU330992 China       B 1 344 13L,76D,127L,134D,207M,253I,256G,267*,271Q,278I,309L,332N
EU330993 China       B 1 344 9Y,76D,79X,134D,207I,253I,256G,267W,271Q,278I,309L,332N
EU330994 China       B 1 344 13L,67R,76D,134D,193K,207M,253I,256G,267W,271Q,278I,287*,309K,332N
EU330995 China       B 1 344 32R,40P,76D,134D,204V,207M,225A,253I,256G,267W,271Q,278T,309L,332N
EU330996 China       B 1 344 76D,134D,207M,253I,256G,267W,271Q,278I,309L,332N
EU330997 China       B 1 344 76D,134D,207M,253I,256G,267W,271Q,278I,309L,332N
EU330998 China       B 1 344 13L,76D,134D,207M,253I,256G,267*,271Q,278T,309L,332N
EU330999 China       B 1 344 13L,76D,134D,207M,253I,256G,267*,271Q,278T,309L,332N
EU331000 China       B 1 344 13L,76D,134D,207M,253I,256G,267*,271Q,278T,309L,332N
EU331001 China       B 1 344 13L,76D,134D,207M,253I,256G,267*,271Q,278T,309L,332N

Team

Resources